PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G01580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 312aa    MW: 31024.8 Da    PI: 5.3325
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G01580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.1e-051658542
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      C  ++   +  +C  +   lC  C  + H        H++vpl
  OMERI10G01580.1 16 ACGVCGGA-AAVYCAADAAALCVPCDAAVHAAnplasrHDRVPL 58
                     59****99.*********************66899999999986 PP

2CCT66.67.1e-23203246144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Re++++RY+eKrk+RkF+K+irY+sRKa+Ae RpR+KGrFvk+a
  OMERI10G01580.1 203 REERVRRYREKRKNRKFQKTIRYASRKAYAEARPRIKGRFVKRA 246
                      9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.9E-91258IPR000315B-box-type zinc finger
PROSITE patternPS0019701220IPR0060582Fe-2S ferredoxin, iron-sulphur binding site
PROSITE profilePS501199.2431758IPR000315B-box-type zinc finger
PROSITE profilePS5101716.479203245IPR010402CCT domain
PfamPF062032.1E-17203245IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0051537Molecular Function2 iron, 2 sulfur cluster binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MASDGSASPA SCGGAACGVC GGAAAVYCAA DAAALCVPCD AAVHAANPLA SRHDRVPLAV  60
AMAAASSGVY DHLFAPDDDA ASSWAAAAAA TQGGLGQGQG SPNDSSSSFT NDSAGGGGRG  120
AAERSLFDLL SDVDIMSCGG GGLASSFDGA XXXXXASSFD GAAAPPLWLH PGQLAALTPW  180
SPADSVVVPT SADGAVAAAA AAREERVRRY REKRKNRKFQ KTIRYASRKA YAEARPRIKG  240
RFVKRATAAA SSSSDDDSTA AAGVSGAGGA GTAATEEAKF WLSFSDDGRA DGVGFYMDNA  300
TAAAAYGVVP TF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054950.0AP005495.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0003H03.
GenBankAP0057990.0AP005799.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0012K14.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648718.11e-125PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0EVN90.0A0A0E0EVN9_9ORYZ; Uncharacterized protein
STRINGORGLA08G0066300.11e-132(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130662224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.15e-10CONSTANS-like 5